PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g003010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 754aa    MW: 84187.2 Da    PI: 5.6993
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g003010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.5e-182979656
                    S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    ++t++q++ Le++F ++++p++++ ++L ++l+L  +qVk+WFqN+R++ k
  Csa15g003010.1 29 RHTPQQIQGLEAFFMECPHPDEAQQQQLCEELKLGPDQVKFWFQNKRTQCK 79
                    68*********************************************9988 PP

2START119.25.7e-382194384206
                     HHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
           START   4 eeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                      +a +el ++   ee++Wvkss       +sen+++    +++ ++   ++e +++++vv+ ++++l e +ld    W+e ++    ka+tl v+
  Csa15g003010.1 219 ASAVEELKRLFFTEEQFWVKSSidgtdliDSENYEKFSNAVKKFRGtsAHVESSKDVTVVPIEATNLIEMFLDAE-NWKELFPtmvnKAKTLHVL 312
                     66778888888899***********888888888887777755444889************************99.88888877777******** PP

                     CTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
           START  86 ssg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                      s        ++l +m  +l  lsplvp R+f++vR++++ ++g w+i+dvS +++ ++  ++s+    ++pSg+li++++n  skv w+ehv++
  Csa15g003010.1 313 GSElpirencNILRVMWEQLHILSPLVPpREFMIVRCCQEISKGLWIIADVSHNVDFDVC-NASC---YKRPSGCLIQSLPNAQSKVMWIEHVEV 403
                     ****************************************************99999998.4555...559************************ PP

                     -SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 173 kgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                       +l  h ++r l++ g   gak+w atl+r ce+
  Csa15g003010.1 404 AHKLDtHKIYRELLSGGSGYGAKRWIATLERMCER 438
                     ****99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-17983IPR009057Homeodomain-like
SuperFamilySSF466894.71E-17982IPR009057Homeodomain-like
PROSITE profilePS5007114.7382181IPR001356Homeobox domain
SMARTSM003891.7E-162385IPR001356Homeobox domain
CDDcd000861.55E-152482No hitNo description
PfamPF000463.5E-152979IPR001356Homeobox domain
PROSITE profilePS5084838.742207441IPR002913START domain
CDDcd088755.87E-86212437No hitNo description
SuperFamilySSF559616.59E-26212439No hitNo description
SMARTSM002341.2E-21216438IPR002913START domain
PfamPF018521.8E-31219438IPR002913START domain
Gene3DG3DSA:3.30.530.203.1E-6252401IPR023393START-like domain
SuperFamilySSF559611.37E-5546718No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MENDGSGSSG NEQYASEDSN QSGKRIGHRH TPQQIQGLEA FFMECPHPDE AQQQQLCEEL  60
KLGPDQVKFW FQNKRTQCKA QQEKTNNLSF REENEILKNK NKAMLETLSS ALCPDCGGPP  120
FGIEERALNF QKLFLENARL KEQRDIISHL LSNMSKRPTV GDSLASDPTQ HIFDHISYYG  180
INPSNMFNPS SSFGPPTSLP IQPQPLSPMH VSLLSETAAS AVEELKRLFF TEEQFWVKSS  240
IDGTDLIDSE NYEKFSNAVK KFRGTSAHVE SSKDVTVVPI EATNLIEMFL DAENWKELFP  300
TMVNKAKTLH VLGSELPIRE NCNILRVMWE QLHILSPLVP PREFMIVRCC QEISKGLWII  360
ADVSHNVDFD VCNASCYKRP SGCLIQSLPN AQSKVMWIEH VEVAHKLDTH KIYRELLSGG  420
SGYGAKRWIA TLERMCERMA LTSNLTLPAS DWSEVIRTGE ERRRVLKLGE RMIMNFNEML  480
TMSGKVDFPQ QSKCGVRVSM RMNLEAGQPP GLIVSAASSL RIPLPPVQVF DILRKLDTRQ  540
QQSKCGVRVS MRMNLEAGQP PGLIVSAASS LRIPLPPVQV FDILRKLDTR QQWDVLAYGT  600
VVTEIARIAT GSSETNCLSI LRPTQEENNG KLMAQDSDKD DMLMLQDCYM DALGGMLVYA  660
PMDMATMDTT LSGADVKISD IPILPSGFII SSDGRRSTVE DGETLLTLAF QILVSGKTST  720
SREVNERSVD TVSALISSTV QRIKGLLNCP DQF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010463773.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like
SwissprotQ9M9P40.0HDG8_ARATH; Homeobox-leucine zipper protein HDG8
TrEMBLR0HRS60.0R0HRS6_9BRAS; Uncharacterized protein
STRINGAT3G03260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM127911530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.10.0homeodomain GLABROUS 8